SCOPe 2.06: Domain d5c2ab1: 5c2a B:439-759

Lineage for d5c2ab1 (5c2a B:439-759)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries)

8. Domain d5c2ab1: 5c2a B:439-759 [277497]
   Other proteins in same PDB: d5c2aa2, d5c2ab2
   automated match to d2ourb_
   complexed with 4y2, mg, zn

Details for d5c2ab1

PDB Entry: 5c2a, 2 Å

PDB Description: pde10 complexed with 6-chloro-2-cyclopropyl-n-[(2,4-dimethylthiazol-5- yl)methyl]-5-methyl-pyrimidin-4-amine

PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5c2ab1:

Sequence; same for both SEQRES and ATOM records:

>d5c2ab1 a.211.1.0 (B:439-759) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirge

Timeline for d5c2ab1:

• d5c2ab1 first appeared in SCOPe 2.05, called d5c2ab_
  
• d5c2ab1 appears in SCOPe 2.07
  
• d5c2ab1 appears in the current release, SCOPe 2.08