Lineage for d4yz1a1 (4yz1 A:84-273)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1782163Species Streptococcus pneumoniae [TaxId:170187] [277427] (1 PDB entry)
  8. 1782164Domain d4yz1a1: 4yz1 A:84-273 [277428]
    Other proteins in same PDB: d4yz1a2, d4yz1b2
    automated match to d2slia1
    complexed with so4

Details for d4yz1a1

PDB Entry: 4yz1 (more details), 1.97 Å

PDB Description: crystal structure of streptococcus pneumoniae nanc, apo structure.
PDB Compounds: (A:) Putative neuraminidase

SCOPe Domain Sequences for d4yz1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yz1a1 b.29.1.0 (A:84-273) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
tpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqqn
syvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktysl
yangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldeet
vkkmttnavt

SCOPe Domain Coordinates for d4yz1a1:

Click to download the PDB-style file with coordinates for d4yz1a1.
(The format of our PDB-style files is described here.)

Timeline for d4yz1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yz1a2