Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (44 species) not a true protein |
Species Helogale parvula [TaxId:210647] [277372] (2 PDB entries) |
Domain d4yu4a_: 4yu4 A: [277375] automated match to d3lqda_ complexed with hem, oxy |
PDB Entry: 4yu4 (more details), 2.8 Å
SCOPe Domain Sequences for d4yu4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yu4a_ a.1.1.2 (A:) automated matches {Helogale parvula [TaxId: 210647]} vlspadktnikaswekigshggeygaealertflcfpttktyfphfdlshgsaqvkahgk kvadaltnavghlddlpgalsalsdlhayklrvdpvnfkllshcllvtlashhpaeftpa vhasldkflssvstvltskyr
Timeline for d4yu4a_: