SCOPe 2.07: Domain d4wwqb1: 4wwq B:415-532

Lineage for d4wwqb1 (4wwq B:415-532)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Growth factor receptor-bound protein 7 [103135] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103136] (4 PDB entries)

8. Domain d4wwqb1: 4wwq B:415-532 [277335]
   Other proteins in same PDB: d4wwqb2
   automated match to d1mw4a_
   complexed with mla

Details for d4wwqb1

PDB Entry: 4wwq, 1.8 Å

PDB Description: apo structure of the grb7 sh2 domain

PDB Compounds: (B:) Growth factor receptor-bound protein 7

SCOPe Domain Sequences for d4wwqb1:

Sequence; same for both SEQRES and ATOM records:

>d4wwqb1 d.93.1.1 (B:415-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]}
pasgtslsaaihrtqlwfhgrisreesqrligqqglvdglflvresqrnpqgfvlslchl
qkvkhylilpseeegrlyfsmddgqtrftdllqlvefhqlnrgilpcllrhcctrval

Timeline for d4wwqb1:

• d4wwqb1 first appeared in SCOPe 2.05, called d4wwqb_
  
• d4wwqb1 appears in SCOPe 2.06
  
• d4wwqb1 appears in the current release, SCOPe 2.08