Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries) |
Domain d5cgta3: 5cgt A:407-495 [27731] Other proteins in same PDB: d5cgta1, d5cgta2, d5cgta4 complexed with ca, glc; mutant |
PDB Entry: 5cgt (more details), 2.5 Å
SCOPe Domain Sequences for d5cgta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cgta3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]} gstqqrwinndvyvyerkfgksvavvavnrnlstsasitglstslptgsytdvlggvlng nnitstngsinnftlaagatavwqyttae
Timeline for d5cgta3: