Lineage for d5cgta3 (5cgt A:407-495)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1555654Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1555802Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 1555803Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)
  8. 1555836Domain d5cgta3: 5cgt A:407-495 [27731]
    Other proteins in same PDB: d5cgta1, d5cgta2, d5cgta4
    complexed with ca, glc; mutant

Details for d5cgta3

PDB Entry: 5cgt (more details), 2.5 Å

PDB Description: maltotriose complex of preconditioned cyclodextrin glycosyltransferase mutant
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d5cgta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cgta3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
gstqqrwinndvyvyerkfgksvavvavnrnlstsasitglstslptgsytdvlggvlng
nnitstngsinnftlaagatavwqyttae

SCOPe Domain Coordinates for d5cgta3:

Click to download the PDB-style file with coordinates for d5cgta3.
(The format of our PDB-style files is described here.)

Timeline for d5cgta3: