| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
| Protein Xylanase II [49979] (21 species) Partial overlap with common fold and the active sites of the other endoglucanases |
| Species Trichoderma reesei, xynII [TaxId:51453] [49985] (16 PDB entries) |
| Domain d4s2da_: 4s2d A: [277302] automated match to d1enxa_ complexed with dod, iod, mes |
PDB Entry: 4s2d (more details), 1.6 Å
SCOPe Domain Sequences for d4s2da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4s2da_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs
Timeline for d4s2da_: