Lineage for d5d8oc_ (5d8o C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991631Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1991632Protein automated matches [190036] (39 species)
    not a true protein
  7. 1992082Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [270448] (9 PDB entries)
  8. 1992097Domain d5d8oc_: 5d8o C: [277185]
    automated match to d3fvba_
    complexed with hem, k, pg4

Details for d5d8oc_

PDB Entry: 5d8o (more details), 1.9 Å

PDB Description: 1.90a resolution structure of bfrb (wild-type, c2221 form) from pseudomonas aeruginosa
PDB Compounds: (C:) Ferroxidase

SCOPe Domain Sequences for d5d8oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d8oc_ a.25.1.0 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
kdileseeehidyletqlgliqkvglenylqshmhe

SCOPe Domain Coordinates for d5d8oc_:

Click to download the PDB-style file with coordinates for d5d8oc_.
(The format of our PDB-style files is described here.)

Timeline for d5d8oc_: