Lineage for d5c38a1 (5c38 A:64-347)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133477Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 protein domains)
    automatically mapped to Pfam PF03414
  6. 2133594Protein automated matches [190178] (2 species)
    not a true protein
  7. 2133601Species Human (Homo sapiens) [TaxId:9606] [186910] (75 PDB entries)
  8. 2133634Domain d5c38a1: 5c38 A:64-347 [277089]
    Other proteins in same PDB: d5c38a2
    automated match to d3v0qa_
    complexed with da8, mn, urm

Details for d5c38a1

PDB Entry: 5c38 (more details), 1.45 Å

PDB Description: crystal structure of aabb + udp-c-gal + di
PDB Compounds: (A:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d5c38a1:

Sequence, based on SEQRES records: (download)

>d5c38a1 c.68.1.9 (A:64-347) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwqd
vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssrea
ftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhde
shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpkn

Sequence, based on observed residues (ATOM records): (download)

>d5c38a1 c.68.1.9 (A:64-347) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevramrrmem
isfcerflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssreaftyerrpqsq
ayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrh
kptkvlspeylwdqqllgwpavlrklrftavpkn

SCOPe Domain Coordinates for d5c38a1:

Click to download the PDB-style file with coordinates for d5c38a1.
(The format of our PDB-style files is described here.)

Timeline for d5c38a1:

  • d5c38a1 first appeared in SCOPe 2.05, called d5c38a_

View in 3D
Domains from same chain:
(mouse over for more information)
d5c38a2