SCOPe 2.07: Domain d1n50a2: 1n50 A:118-543

Lineage for d1n50a2 (1n50 A:118-543)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family)

5. Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)

6. Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (4 species)
   the N-terminal domain is cytochrome c-like

7. Species Pseudomonas aeruginosa [TaxId:287] [51008] (9 PDB entries)

8. Domain d1n50a2: 1n50 A:118-543 [27708]
   Other proteins in same PDB: d1n50a1, d1n50b1
   complexed with dhe, hec

Details for d1n50a2

PDB Entry: 1n50, 2.9 Å

PDB Description: following the c heme reduction in nitrite reductase from pseudomonas aeruginosa

PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1n50a2:

Sequence; same for both SEQRES and ATOM records:

>d1n50a2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}
ewgmpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidt
gyavhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyed
rytiagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivn
vketgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrr
lsalvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelq
gqgggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgeg
akrvvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyn
tqhdvy

Timeline for d1n50a2:

• d1n50a2 first appeared (with stable ids) in SCOP 1.55
  
• d1n50a2 appears in SCOPe 2.06
  
• d1n50a2 appears in the current release, SCOPe 2.08