SCOPe 2.08: Domain d4zrnb_: 4zrn B:

Lineage for d4zrnb_ (4zrn B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [224971] (9 PDB entries)

8. Domain d4zrnb_: 4zrn B: [277055]
   automated match to d4egba_
   complexed with nad, upg

Details for d4zrnb_

PDB Entry: 4zrn, 2 Å

PDB Description: crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima

PDB Compounds: (B:) UDP-glucose 4-epimerase

SCOPe Domain Sequences for d4zrnb_:

Sequence; same for both SEQRES and ATOM records:

>d4zrnb_ c.2.1.0 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
mnilvtggagfigshvvdkliengygvivvdnlssgkvenlnrnalfyeqsiedeemmer
ifslhrpeyvfhlaaqasvaisvrepardaktniigslvlleksikygvkkfifsstgga
iygenvkvfptpeteiphpispygiakystemyleffareyglkytvlryanvygprqdp
ygeagvvaiftermlrgeevhifgdgeyvrdyvyvddvvranllamekgdnevfnigtgr
gttvnqlfkllkeitgydkepvykpprkgdvrksildytkakeklgwepkvsleeglklt
veyfrktl

Timeline for d4zrnb_:

• d4zrnb_ first appeared in SCOPe 2.05
  
• d4zrnb_ appears in SCOPe 2.07