Lineage for d4zrnb_ (4zrn B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848846Species Thermotoga maritima [TaxId:243274] [224971] (9 PDB entries)
  8. 2848855Domain d4zrnb_: 4zrn B: [277055]
    automated match to d4egba_
    complexed with nad, upg

Details for d4zrnb_

PDB Entry: 4zrn (more details), 2 Å

PDB Description: crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima
PDB Compounds: (B:) UDP-glucose 4-epimerase

SCOPe Domain Sequences for d4zrnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zrnb_ c.2.1.0 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
mnilvtggagfigshvvdkliengygvivvdnlssgkvenlnrnalfyeqsiedeemmer
ifslhrpeyvfhlaaqasvaisvrepardaktniigslvlleksikygvkkfifsstgga
iygenvkvfptpeteiphpispygiakystemyleffareyglkytvlryanvygprqdp
ygeagvvaiftermlrgeevhifgdgeyvrdyvyvddvvranllamekgdnevfnigtgr
gttvnqlfkllkeitgydkepvykpprkgdvrksildytkakeklgwepkvsleeglklt
veyfrktl

SCOPe Domain Coordinates for d4zrnb_:

Click to download the PDB-style file with coordinates for d4zrnb_.
(The format of our PDB-style files is described here.)

Timeline for d4zrnb_: