Lineage for d4y86b_ (4y86 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1753307Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1753308Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1753393Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 1753611Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)
  7. 1753615Species Human (Homo sapiens) [TaxId:9606] [109943] (19 PDB entries)
    Uniprot O76083 241-566
  8. 1753635Domain d4y86b_: 4y86 B: [277033]
    automated match to d2hd1a_
    complexed with 49d, 49e, mg, zn

Details for d4y86b_

PDB Entry: 4y86 (more details), 2.01 Å

PDB Description: crystal structure of pde9 in complex with racemic inhibitor c33
PDB Compounds: (B:) High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d4y86b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y86b_ a.211.1.2 (B:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcl
leeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeiml
qplwesrdryeelkriddamkelqkk

SCOPe Domain Coordinates for d4y86b_:

Click to download the PDB-style file with coordinates for d4y86b_.
(The format of our PDB-style files is described here.)

Timeline for d4y86b_: