Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.59: Rnp2-like [160350] (1 family) contains extra C-terminal helix automatically mapped to Pfam PF01900 |
Family d.58.59.1: Rpp14/Pop5-like [160351] (2 proteins) Pfam PF01900 |
Protein automated matches [277005] (1 species) not a true protein |
Species Thermococcus kodakarensis [TaxId:69014] [277006] (1 PDB entry) |
Domain d3wz0a_: 3wz0 A: [277012] Other proteins in same PDB: d3wz0e_, d3wz0f_ automated match to d2czvd_ |
PDB Entry: 3wz0 (more details), 2.79 Å
SCOPe Domain Sequences for d3wz0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wz0a_ d.58.59.1 (A:) automated matches {Thermococcus kodakarensis [TaxId: 69014]} nryiafqvigerpfkkdeikkavweaslsalgylgsarakpwfikfdeksqtgivrvdrk hveelrfaltmlteingskvifrtlgvsgtikrlkrkflaeygw
Timeline for d3wz0a_: