Lineage for d3wz0a_ (3wz0 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2198957Superfamily d.58.59: Rnp2-like [160350] (1 family) (S)
    contains extra C-terminal helix
    automatically mapped to Pfam PF01900
  5. 2198958Family d.58.59.1: Rpp14/Pop5-like [160351] (2 proteins)
    Pfam PF01900
  6. 2198969Protein automated matches [277005] (1 species)
    not a true protein
  7. 2198970Species Thermococcus kodakarensis [TaxId:69014] [277006] (1 PDB entry)
  8. 2198971Domain d3wz0a_: 3wz0 A: [277012]
    Other proteins in same PDB: d3wz0e_, d3wz0f_
    automated match to d2czvd_

Details for d3wz0a_

PDB Entry: 3wz0 (more details), 2.79 Å

PDB Description: on archaeal homologs of the human rnase p proteins pop5 and rpp30 in the hyperthermophilic archaeon thermococcus kodakarensis
PDB Compounds: (A:) Ribonuclease P protein component 2

SCOPe Domain Sequences for d3wz0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wz0a_ d.58.59.1 (A:) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
nryiafqvigerpfkkdeikkavweaslsalgylgsarakpwfikfdeksqtgivrvdrk
hveelrfaltmlteingskvifrtlgvsgtikrlkrkflaeygw

SCOPe Domain Coordinates for d3wz0a_:

Click to download the PDB-style file with coordinates for d3wz0a_.
(The format of our PDB-style files is described here.)

Timeline for d3wz0a_: