Lineage for d5dd7a2 (5dd7 A:137-305)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928072Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 1928073Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 1928142Family d.139.1.0: automated matches [227182] (1 protein)
    not a true family
  6. 1928143Protein automated matches [226902] (9 species)
    not a true protein
  7. 1928144Species Acinetobacter baumannii [TaxId:470] [276304] (3 PDB entries)
  8. 1928147Domain d5dd7a2: 5dd7 A:137-305 [276912]
    Other proteins in same PDB: d5dd7a1, d5dd7b1
    automated match to d3mcqa2
    complexed with anp, edo, k, mg, tps

Details for d5dd7a2

PDB Entry: 5dd7 (more details), 1.7 Å

PDB Description: structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with amppnp and thiamine-monophosphate
PDB Compounds: (A:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d5dd7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dd7a2 d.139.1.0 (A:137-305) automated matches {Acinetobacter baumannii [TaxId: 470]}
tgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldyptprcklgeelkglassm
idvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrwqyalaggddyelcfti
tpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqihgyqhfa

SCOPe Domain Coordinates for d5dd7a2:

Click to download the PDB-style file with coordinates for d5dd7a2.
(The format of our PDB-style files is described here.)

Timeline for d5dd7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5dd7a1