| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) ![]() |
| Family d.139.1.0: automated matches [227182] (1 protein) not a true family |
| Protein automated matches [226902] (9 species) not a true protein |
| Species Methylobacillus flagellatus [TaxId:265072] [225899] (1 PDB entry) |
| Domain d3mcqa2: 3mcq A:136-308 [213205] Other proteins in same PDB: d3mcqa1 automated match to d3c9ua2 complexed with 1pe, na, peg, pg4, pge |
PDB Entry: 3mcq (more details), 1.91 Å
SCOPe Domain Sequences for d3mcqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mcqa2 d.139.1.0 (A:136-308) automated matches {Methylobacillus flagellatus [TaxId: 265072]}
pgasllrstaradddiwvsgplgdaalalaaiqgryplsdtelaacgkalhqpqprvvlg
qalrglahsaldisdglladlghilehsqvgaevwlkaipksevvsahsqevaiqkmils
ggddyelcftastqhrqqiadigrqlsldmavigritdtqqlvihglddaplt
Timeline for d3mcqa2: