| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) ![]() |
| Family d.79.4.0: automated matches [227181] (1 protein) not a true family |
| Protein automated matches [226901] (10 species) not a true protein |
| Species Acinetobacter baumannii [TaxId:470] [276302] (4 PDB entries) |
| Domain d5dd7a1: 5dd7 A:1-136 [276911] Other proteins in same PDB: d5dd7a2, d5dd7b2 automated match to d3mcqa1 complexed with anp, edo, k, mg, tps |
PDB Entry: 5dd7 (more details), 1.7 Å
SCOPe Domain Sequences for d5dd7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dd7a1 d.79.4.0 (A:1-136) automated matches {Acinetobacter baumannii [TaxId: 470]}
maefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfpletsphai
gwksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgvaliggdtt
qgphltitvtamgwie
Timeline for d5dd7a1: