SCOPe 2.08: Domain d1hj4b2: 1hj4 B:134-567

Lineage for d1hj4b2 (1hj4 B:134-567)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family)

5. Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)

6. Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (4 species)
   the N-terminal domain is cytochrome c-like

7. Species Paracoccus pantotrophus [TaxId:82367] [51007] (11 PDB entries)
   formerly Thiosphaera pantotropha

8. Domain d1hj4b2: 1hj4 B:134-567 [27691]
   Other proteins in same PDB: d1hj4a1, d1hj4b1
   complexed with dhe, gol, hec, so4

Details for d1hj4b2

PDB Entry: 1hj4, 1.6 Å

PDB Description: cytochrome cd1 nitrite reductase, x-ray reduced dioxygen complex

PDB Compounds: (B:) nitrite reductase

SCOPe Domain Sequences for d1hj4b2:

Sequence; same for both SEQRES and ATOM records:

>d1hj4b2 b.70.2.1 (B:134-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]}
ppefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqialidgatyeiksvl
dtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegw
edkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefi
vnvketgkillvdytdldnlktteisaerflhdggldgshryfitaanarnklvvidtke
gklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkild
sfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpia
ewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtp
tgkfnvyntmtdty

Timeline for d1hj4b2:

• d1hj4b2 first appeared (with stable ids) in SCOP 1.55
  
• d1hj4b2 appears in SCOPe 2.07