Lineage for d5cvvb1 (5cvv B:16-122)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308050Species Clarkia breweri [TaxId:36903] [226317] (5 PDB entries)
  8. 2308056Domain d5cvvb1: 5cvv B:16-122 [276889]
    Other proteins in same PDB: d5cvva2, d5cvvb2
    automated match to d1kyze1
    complexed with n7i, sah

Details for d5cvvb1

PDB Entry: 5cvv (more details), 1.73 Å

PDB Description: coniferyl alcohol bound monolignol 4-o-methyltransferase 9
PDB Compounds: (B:) (Iso)eugenol O-methyltransferase

SCOPe Domain Sequences for d5cvvb1:

Sequence, based on SEQRES records: (download)

>d5cvvb1 a.4.5.0 (B:16-122) automated matches {Clarkia breweri [TaxId: 36903]}
ssdeeanlfahqlaraaslpmalkaaieldvleimaksvppsgyispaeiaaqlpttnpe
apvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne

Sequence, based on observed residues (ATOM records): (download)

>d5cvvb1 a.4.5.0 (B:16-122) automated matches {Clarkia breweri [TaxId: 36903]}
ssdeeanlfahqlaraaslpmalkaaieldvleimaksvppsgyispaeiaaqlpttnpe
apvmldrvlrllasysvvtytlrverlyglapvckfltkne

SCOPe Domain Coordinates for d5cvvb1:

Click to download the PDB-style file with coordinates for d5cvvb1.
(The format of our PDB-style files is described here.)

Timeline for d5cvvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5cvvb2