Lineage for d1e5ta1 (1e5t A:1-430)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.69: 7-bladed beta-propeller [50964] (9 superfamilies) 
Superfamily b.69.7: Prolyl oligopeptidase, N-terminal domain [50993] (1 family) 
Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (1 protein) Protein Prolyl oligopeptidase, N-terminal domain [50995] (1 species) Species Pig (Sus scrofa) [TaxId:9823] [50996] (5 PDB entries) 
Domain d1e5ta1: 1e5t A:1-430 [27676]
Other proteins in same PDB: d1e5ta2
Details for d1e5ta1
PDB Entry: 1e5t (more details), 1.7 Å
PDB Description: prolyl oligopeptidase from porcine brain, mutant
SCOP Domain Sequences for d1e5ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5ta1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa)}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
sddgryvllsiregtdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
lqlhdlatgallkifplevgsvvgysgqkkdteifycftsflspgiiyhcdltkeelepr
vfrevtvkgi
SCOP Domain Coordinates for d1e5ta1:
Click to download the PDB-style file with coordinates for d1e5ta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e5ta1:
- d1e5ta1 first appeared (with stable ids) in SCOP 1.55
- d1e5ta1 appears in SCOP 1.57
- d1e5ta1 appears in SCOP 1.61
- d1e5ta1 appears in the current release, SCOPe 2.08
View in 3D
