Lineage for d1a0rb_ (1a0r B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1554689Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1554832Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 1554833Family b.69.4.1: WD40-repeat [50979] (11 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 1554856Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (1 species)
  7. 1554857Species Cow (Bos taurus) [TaxId:9913] [50981] (20 PDB entries)
  8. 1554874Domain d1a0rb_: 1a0r B: [27658]
    Other proteins in same PDB: d1a0rg_, d1a0rp_
    complexed with far

Details for d1a0rb_

PDB Entry: 1a0r (more details), 2.8 Å

PDB Description: heterotrimeric complex of phosducin/transducin beta-gamma
PDB Compounds: (B:) transducin (beta subunit)

SCOPe Domain Sequences for d1a0rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0rb_ b.69.4.1 (B:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}
seldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiyam
hwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldnic
siynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttft
ghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngnaf
atgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdalk
adragvlaghdnrvsclgvtddgmavatgswdsflkiwn

SCOPe Domain Coordinates for d1a0rb_:

Click to download the PDB-style file with coordinates for d1a0rb_.
(The format of our PDB-style files is described here.)

Timeline for d1a0rb_: