Lineage for d5cc8a1 (5cc8 A:3-136)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914717Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 1914789Family d.79.4.0: automated matches [227181] (1 protein)
    not a true family
  6. 1914790Protein automated matches [226901] (8 species)
    not a true protein
  7. 1914798Species Acinetobacter baumannii [TaxId:525243] [276532] (1 PDB entry)
  8. 1914799Domain d5cc8a1: 5cc8 A:3-136 [276536]
    Other proteins in same PDB: d5cc8a2, d5cc8b2
    automated match to d3mcqa1
    complexed with anp, cl, k, mg

Details for d5cc8a1

PDB Entry: 5cc8 (more details), 1.75 Å

PDB Description: structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with amppnp
PDB Compounds: (A:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d5cc8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cc8a1 d.79.4.0 (A:3-136) automated matches {Acinetobacter baumannii [TaxId: 525243]}
efsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfpletsphaigw
ksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgvaliggdttqg
phltitvtamgwie

SCOPe Domain Coordinates for d5cc8a1:

Click to download the PDB-style file with coordinates for d5cc8a1.
(The format of our PDB-style files is described here.)

Timeline for d5cc8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5cc8a2