SCOPe 2.08: Domain d5cc8a1: 5cc8 A:3-136

Lineage for d5cc8a1 (5cc8 A:3-136)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families)

5. Family d.79.4.0: automated matches [227181] (1 protein)
   not a true family

6. Protein automated matches [226901] (10 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:525243] [276532] (1 PDB entry)

8. Domain d5cc8a1: 5cc8 A:3-136 [276536]
   Other proteins in same PDB: d5cc8a2, d5cc8b2
   automated match to d3mcqa1
   complexed with anp, cl, k, mg

Details for d5cc8a1

PDB Entry: 5cc8, 1.75 Å

PDB Description: structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with amppnp

PDB Compounds: (A:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d5cc8a1:

Sequence; same for both SEQRES and ATOM records:

>d5cc8a1 d.79.4.0 (A:3-136) automated matches {Acinetobacter baumannii [TaxId: 525243]}
efsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfpletsphaigw
ksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgvaliggdttqg
phltitvtamgwie

Timeline for d5cc8a1:

• d5cc8a1 first appeared in SCOPe 2.05
  
• d5cc8a1 appears in SCOPe 2.07