Lineage for d5cb8b_ (5cb8 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480965Species Synechocystis sp. [TaxId:1111708] [276277] (3 PDB entries)
  8. 2480967Domain d5cb8b_: 5cb8 B: [276531]
    automated match to d4bzpa_
    complexed with act, adx, so4

Details for d5cb8b_

PDB Entry: 5cb8 (more details), 1.88 Å

PDB Description: crystal structure of adenosine-5'-phosphosulfate kinase in complex with aps and sulfate
PDB Compounds: (B:) Probable adenylyl-sulfate kinase

SCOPe Domain Sequences for d5cb8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cb8b_ c.37.1.0 (B:) automated matches {Synechocystis sp. [TaxId: 1111708]}
qqrgvtiwltglsgagkttithalekklrdsgyrlevldgdvvrtnltkglgfskedrdt
nirrigfvshlltrngvivlvsaispyaairqevkhtigdflevfvnaplavceerdvkg
lyakarsgeikgftgiddpyepptnpdvecrtdleeldesvgkiwqklvdlkyieg

SCOPe Domain Coordinates for d5cb8b_:

Click to download the PDB-style file with coordinates for d5cb8b_.
(The format of our PDB-style files is described here.)

Timeline for d5cb8b_: