Lineage for d1euta3 (1eut A:47-402)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065183Protein Micromonospora sialidase, N-terminal domain [50946] (1 species)
  7. 2065184Species Micromonospora viridifaciens [TaxId:1881] [50947] (6 PDB entries)
    Uniprot Q02834 47-647
  8. 2065189Domain d1euta3: 1eut A:47-402 [27609]
    Other proteins in same PDB: d1euta1, d1euta2
    complexed with na

Details for d1euta3

PDB Entry: 1eut (more details), 2.5 Å

PDB Description: sialidase, large 68kd form, complexed with galactose
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d1euta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euta3 b.68.1.1 (A:47-402) Micromonospora sialidase, N-terminal domain {Micromonospora viridifaciens [TaxId: 1881]}
geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlg

SCOPe Domain Coordinates for d1euta3:

Click to download the PDB-style file with coordinates for d1euta3.
(The format of our PDB-style files is described here.)

Timeline for d1euta3: