Lineage for d4uulb1 (4uul B:2-154)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848956Species Trichomonas vaginalis [TaxId:5722] [276010] (5 PDB entries)
  8. 2848958Domain d4uulb1: 4uul B:2-154 [276030]
    Other proteins in same PDB: d4uula2, d4uula3, d4uulb2, d4uulb3
    automated match to d5mdha1

Details for d4uulb1

PDB Entry: 4uul (more details), 1.28 Å

PDB Description: apo trichomonas vaginalis lactate dehydrogenase l91r
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d4uulb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uulb1 c.2.1.0 (B:2-154) automated matches {Trichomonas vaginalis [TaxId: 5722]}
seaahvlitgaagqigyilshwiasgelygdrqvylhlldippamnrltaltmeledcaf
phlagfvattdpkaafkdidcaflvasmprkpgqvradlissnsvifkntgeylskwakp
svkvlvignpdntnceiamlhaknlkpenfssl

SCOPe Domain Coordinates for d4uulb1:

Click to download the PDB-style file with coordinates for d4uulb1.
(The format of our PDB-style files is described here.)

Timeline for d4uulb1: