| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
| Protein automated matches [226850] (26 species) not a true protein |
| Species Trichomonas vaginalis [TaxId:5722] [276012] (4 PDB entries) |
| Domain d4uuna2: 4uun A:155-336 [276025] Other proteins in same PDB: d4uuna1, d4uunb1 automated match to d5mdha2 complexed with nai |
PDB Entry: 4uun (more details), 1.71 Å
SCOPe Domain Sequences for d4uuna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uuna2 d.162.1.0 (A:155-336) automated matches {Trichomonas vaginalis [TaxId: 5722]}
smldqnrayyevasklgvdvkdvhdiivwgnhgesmvadltqatftkegktqkvvdvldh
dyvfdtffkkighrawdilehrgftsaasptkaaiqhmkawlfgtapgevlsmgipvpeg
npygikpgvvfsfpcnvdkegkihvvegfkvndwlrekldftekdlfhekeialnhlaql
eh
Timeline for d4uuna2: