Lineage for d4uuna2 (4uun A:155-333)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2233134Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2233135Protein automated matches [226850] (29 species)
    not a true protein
  7. 2233317Species Trichomonas vaginalis [TaxId:5722] [276012] (5 PDB entries)
  8. 2233322Domain d4uuna2: 4uun A:155-333 [276025]
    Other proteins in same PDB: d4uuna1, d4uuna3, d4uunb1, d4uunb3
    automated match to d5mdha2
    complexed with nai

Details for d4uuna2

PDB Entry: 4uun (more details), 1.71 Å

PDB Description: trichomonas vaginalis lactate dehydrogenase in complex with nadh
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d4uuna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uuna2 d.162.1.0 (A:155-333) automated matches {Trichomonas vaginalis [TaxId: 5722]}
smldqnrayyevasklgvdvkdvhdiivwgnhgesmvadltqatftkegktqkvvdvldh
dyvfdtffkkighrawdilehrgftsaasptkaaiqhmkawlfgtapgevlsmgipvpeg
npygikpgvvfsfpcnvdkegkihvvegfkvndwlrekldftekdlfhekeialnhlaq

SCOPe Domain Coordinates for d4uuna2:

Click to download the PDB-style file with coordinates for d4uuna2.
(The format of our PDB-style files is described here.)

Timeline for d4uuna2: