SCOPe 2.07: Domain d4r1pc2: 4r1p C:328-496

Lineage for d4r1pc2 (4r1p C:328-496)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families)

5. Family b.43.2.0: automated matches [227252] (1 protein)
   not a true family

6. Protein automated matches [227032] (5 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:235909] [275932] (3 PDB entries)

8. Domain d4r1pc2: 4r1p C:328-496 [275963]
   Other proteins in same PDB: d4r1pa1, d4r1pb1, d4r1pc1, d4r1pd1, d4r1pe1, d4r1pf1
   automated match to d2ajta1
   complexed with mn

Details for d4r1pc2

PDB Entry: 4r1p, 2.3 Å

PDB Description: crystal structure of thermophilic geobacillus kaustophilus l-arabinose isomerase with mn2+

PDB Compounds: (C:) L-arabinose isomerase

SCOPe Domain Sequences for d4r1pc2:

Sequence; same for both SEQRES and ATOM records:

>d4r1pc2 b.43.2.0 (C:328-496) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
tsfmedytyhfepgnelilgahmlevcptiaatrprvevhplsiggkedparlvfdggeg
aavnaslidlghrfrlivnevdavkpehdmpklpvarilwkprpslrdsaeawilaggah
htcfsfavtteqlqdfaemagiecvvinehtsvssfknelkwnevfwrg

Timeline for d4r1pc2:

• d4r1pc2 first appeared in SCOPe 2.05
  
• d4r1pc2 appears in SCOPe 2.06
  
• d4r1pc2 appears in the current release, SCOPe 2.08