SCOPe 2.06: Domain d4opjc_: 4opj C:

Lineage for d4opjc_ (4opj C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein BH0863-like Ribonuclease H [142490] (3 species)
   new class of RNase H

7. Species Bacillus halodurans [TaxId:86665] [142491] (21 PDB entries)
   Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193
   BH0863

8. Domain d4opjc_: 4opj C: [275920]
   automated match to d1zbfa1
   protein/DNA complex; complexed with gol

Details for d4opjc_

PDB Entry: 4opj, 1.54 Å

PDB Description: bh-rnaseh:tcda-dna complex

PDB Compounds: (C:) Ribonuclease H

SCOPe Domain Sequences for d4opjc_:

Sequence; same for both SEQRES and ATOM records:

>d4opjc_ c.55.3.1 (C:) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglrylk
ernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilkw
qtdkwgeikady

Timeline for d4opjc_:

• d4opjc_ first appeared in SCOPe 2.05
  
• d4opjc_ appears in SCOPe 2.07
  
• d4opjc_ appears in the current release, SCOPe 2.08