SCOPe 2.07: Domain d4yojb_: 4yoj B:

Lineage for d4yojb_ (4yoj B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (33 species)
   not a true protein

7. Species Tylonycteris bat coronavirus hku4 [TaxId:694007] [228570] (6 PDB entries)

8. Domain d4yojb_: 4yoj B: [275735]
   automated match to d2ynaa_
   complexed with act, fmt, rfm

Details for d4yojb_

PDB Entry: 4yoj, 1.9 Å

PDB Description: hku4 3clpro bound to non-covalent inhibitor 2a

PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d4yojb_:

Sequence; same for both SEQRES and ATOM records:

>d4yojb_ b.47.1.0 (B:) automated matches {Tylonycteris bat coronavirus hku4 [TaxId: 694007]}
sglvkmsapsgavencivqvtcgsmtlnglwldntvwcprhimcpadqltdpnydallis
ktnhsfivqkhigaqanlrvvahsmvgvllkltvdvanpstpaytfstvkpgasfsvlac
yngkptgvftvnlrhnstikgsflcgscgsvgytenggvinfvymhqmelsngthtgssf
dgvmygafedkqthqlqltdkyctinvvawlyaavlngckwfvkptrvgivtynewalsn
qftefvgtqsidmlahrtgvsveqmlaaiqslhagfqgktilgqstledeftpddvnmqv
mgvvmq

Timeline for d4yojb_:

• d4yojb_ first appeared in SCOPe 2.05
  
• d4yojb_ appears in SCOPe 2.06
  
• d4yojb_ appears in the current release, SCOPe 2.08