Lineage for d4utka_ (4utk A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2828459Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2828460Protein automated matches [190048] (31 species)
    not a true protein
  7. 2828637Species Pseudomonas putida [TaxId:303] [187793] (24 PDB entries)
  8. 2828651Domain d4utka_: 4utk A: [275692]
    automated match to d3l65a_
    complexed with fnr, so4

Details for d4utka_

PDB Entry: 4utk (more details), 1.44 Å

PDB Description: xena - reduced - y183f variant
PDB Compounds: (A:) xenobiotic reductase

SCOPe Domain Sequences for d4utka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4utka_ c.1.4.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
salfepytlkdvtlrnriaippmcqymaedgmindwhhvhlaglarggagllvveatava
pegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhiaa
ddtrgwetiapsaiafgahlpkvpremtlddiarvkqdfvdaarrardagfewielhfah
gflgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgrd
eqtleesielarrfkaggldllsvsvgftipdtnipwgpafmgpiaervrreaklpvtsa
wgfgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwle

SCOPe Domain Coordinates for d4utka_:

Click to download the PDB-style file with coordinates for d4utka_.
(The format of our PDB-style files is described here.)

Timeline for d4utka_: