Lineage for d5buvc1 (5buv C:2-173)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080920Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2080921Protein automated matches [190388] (23 species)
    not a true protein
  7. 2081120Species Yersinia enterocolitica [TaxId:393305] [275567] (1 PDB entry)
  8. 2081123Domain d5buvc1: 5buv C:2-173 [275570]
    Other proteins in same PDB: d5buva2, d5buvb2, d5buvc2
    automated match to d2ixka_
    complexed with cyt, edo, po4

Details for d5buvc1

PDB Entry: 5buv (more details), 1.75 Å

PDB Description: x-ray structure of wbca from yersinia enterocolitica
PDB Compounds: (C:) Putative epimerase

SCOPe Domain Sequences for d5buvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5buvc1 b.82.1.0 (C:2-173) automated matches {Yersinia enterocolitica [TaxId: 393305]}
iinitelnisgcyliespifsdergefvkthhqeifknfgleipsaeeyysrsknnvirg
mhfqqypddhnklvfcpegevldvfldirkdsntygqfmsfilnphnrrsiflakgiahg
flsmkdntlivcktstvhspsrdsgihwnsfgfkwpvenpiisdkdrnldcf

SCOPe Domain Coordinates for d5buvc1:

Click to download the PDB-style file with coordinates for d5buvc1.
(The format of our PDB-style files is described here.)

Timeline for d5buvc1: