Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (23 species) not a true protein |
Species Yersinia enterocolitica [TaxId:393305] [275567] (1 PDB entry) |
Domain d5buvc1: 5buv C:2-173 [275570] Other proteins in same PDB: d5buva2, d5buvb2, d5buvc2 automated match to d2ixka_ complexed with cyt, edo, po4 |
PDB Entry: 5buv (more details), 1.75 Å
SCOPe Domain Sequences for d5buvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5buvc1 b.82.1.0 (C:2-173) automated matches {Yersinia enterocolitica [TaxId: 393305]} iinitelnisgcyliespifsdergefvkthhqeifknfgleipsaeeyysrsknnvirg mhfqqypddhnklvfcpegevldvfldirkdsntygqfmsfilnphnrrsiflakgiahg flsmkdntlivcktstvhspsrdsgihwnsfgfkwpvenpiisdkdrnldcf
Timeline for d5buvc1:
View in 3D Domains from other chains: (mouse over for more information) d5buva1, d5buva2, d5buvb1, d5buvb2 |