Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (94 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [226105] (8 PDB entries) |
Domain d4u4ma_: 4u4m A: [275453] automated match to d2v9da_ complexed with edo, pyr, ure |
PDB Entry: 4u4m (more details), 3.09 Å
SCOPe Domain Sequences for d4u4ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u4ma_ c.1.10.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc
Timeline for d4u4ma_: