PDB entry 4u4m

View 4u4m on RCSB PDB site
Description: Crystal structure of 0.5M urea unfolded YagE, a KDG aldolase protein in complex with Pyruvate
Class: sugar binding protein
Keywords: TIM barrel, NAL superfamily, KDGA, Schiff base, catalytic triad, Chemical denaturant, Urea promoted unfolding, SUGAR BINDING PROTEIN
Deposited on 2014-07-24, released 2015-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-29, with a file datestamp of 2015-07-24.
Experiment type: XRAY
Resolution: 3.09 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yage
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: YAGE
    Database cross-references and differences (RAF-indexed):
    • PDB 4U4M (0-297)
    Domains in SCOPe 2.07: d4u4ma_
  • Chain 'B':
    Compound: yage
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: YAGE
    Database cross-references and differences (RAF-indexed):
    • PDB 4U4M (0-297)
    Domains in SCOPe 2.07: d4u4mb_
  • Chain 'C':
    Compound: yage
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: YAGE
    Database cross-references and differences (RAF-indexed):
    • PDB 4U4M (0-297)
    Domains in SCOPe 2.07: d4u4mc_
  • Chain 'D':
    Compound: yage
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: YAGE
    Database cross-references and differences (RAF-indexed):
    • PDB 4U4M (0-297)
    Domains in SCOPe 2.07: d4u4md_
  • Heterogens: URE, PYR, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4u4mA (A:)
    alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai
    arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf
    eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk
    gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt
    llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4u4mB (B:)
    alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai
    arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf
    eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk
    gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt
    llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4u4mC (C:)
    alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai
    arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf
    eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk
    gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt
    llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4u4mD (D:)
    alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai
    arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf
    eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk
    gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt
    llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc