Lineage for d4u3sb1 (4u3s B:29-122)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1772845Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families) (S)
  5. 1772858Family b.3.2.0: automated matches [275446] (1 protein)
    not a true family
  6. 1772859Protein automated matches [275447] (1 species)
    not a true protein
  7. 1772860Species Acetivibrio cellulolyticus [TaxId:35830] [275448] (2 PDB entries)
  8. 1772861Domain d4u3sb1: 4u3s B:29-122 [275449]
    Other proteins in same PDB: d4u3sa_, d4u3sb2
    automated match to d2b59b2
    complexed with ca, nhe; mutant

Details for d4u3sb1

PDB Entry: 4u3s (more details), 1.64 Å

PDB Description: crystal structure of coh3scab-xdoc_m1scaa complex: a n-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus
PDB Compounds: (B:) cellulosomal scaffoldin

SCOPe Domain Sequences for d4u3sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u3sb1 b.3.2.0 (B:29-122) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
gttvsgyinpdfvttsttapivkagftveivgttksavtdsngyfeikdvaagtytvkit
kanyltreianvsvtadkelstsaspilmwagdm

SCOPe Domain Coordinates for d4u3sb1:

Click to download the PDB-style file with coordinates for d4u3sb1.
(The format of our PDB-style files is described here.)

Timeline for d4u3sb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4u3sb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4u3sa_