SCOPe 2.08: Domain d4u3sb1: 4u3s B:29-122

Lineage for d4u3sb1 (4u3s B:29-122)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families)

5. Family b.3.2.0: automated matches [275446] (1 protein)
   not a true family

6. Protein automated matches [275447] (3 species)
   not a true protein

7. Species Acetivibrio cellulolyticus [TaxId:35830] [275448] (2 PDB entries)

8. Domain d4u3sb1: 4u3s B:29-122 [275449]
   Other proteins in same PDB: d4u3sa_, d4u3sb2
   automated match to d2b59b2
   complexed with ca, nhe; mutant

Details for d4u3sb1

PDB Entry: 4u3s, 1.64 Å

PDB Description: crystal structure of coh3scab-xdoc_m1scaa complex: a n-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus

PDB Compounds: (B:) cellulosomal scaffoldin

SCOPe Domain Sequences for d4u3sb1:

Sequence; same for both SEQRES and ATOM records:

>d4u3sb1 b.3.2.0 (B:29-122) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
gttvsgyinpdfvttsttapivkagftveivgttksavtdsngyfeikdvaagtytvkit
kanyltreianvsvtadkelstsaspilmwagdm

Timeline for d4u3sb1:

• d4u3sb1 first appeared in SCOPe 2.05
  
• d4u3sb1 appears in SCOPe 2.07