Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Tyrosine kinase Fyn [55559] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55560] (6 PDB entries) |
Domain d4u17a1: 4u17 A:12-112 [275435] Other proteins in same PDB: d4u17a2, d4u17b2, d4u17c2 automated match to d1csza_ complexed with edo, po4 |
PDB Entry: 4u17 (more details), 1.99 Å
SCOPe Domain Sequences for d4u17a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u17a1 d.93.1.1 (A:12-112) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} ewyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddmkgdhvkhykirk ldnggyyittraqfetlqqlvqhyseraaglccrlvvpchk
Timeline for d4u17a1:
View in 3D Domains from other chains: (mouse over for more information) d4u17b1, d4u17b2, d4u17c1, d4u17c2 |