SCOPe 2.08: Domain d4u17a1: 4u17 A:12-112

Lineage for d4u17a1 (4u17 A:12-112)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Tyrosine kinase Fyn [55559] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55560] (6 PDB entries)

8. Domain d4u17a1: 4u17 A:12-112 [275435]
   Other proteins in same PDB: d4u17a2, d4u17b2, d4u17c2
   automated match to d1csza_
   complexed with edo, po4

Details for d4u17a1

PDB Entry: 4u17, 1.99 Å

PDB Description: swapped dimer of the human fyn-sh2 domain

PDB Compounds: (A:) Tyrosine-protein kinase Fyn

SCOPe Domain Sequences for d4u17a1:

Sequence; same for both SEQRES and ATOM records:

>d4u17a1 d.93.1.1 (A:12-112) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]}
ewyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddmkgdhvkhykirk
ldnggyyittraqfetlqqlvqhyseraaglccrlvvpchk

Timeline for d4u17a1:

• d4u17a1 first appeared in SCOPe 2.05, called d4u17a_
  
• d4u17a1 appears in SCOPe 2.07