SCOPe 2.06: Domain d4r7dp2: 4r7d P:107-212

Lineage for d4r7dp2 (4r7d P:107-212)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
Domain d4r7dp2: 4r7d P:107-212 [275426]
Other proteins in same PDB: d4r7db1, d4r7dd1, d4r7df1, d4r7dh1, d4r7dj1, d4r7dl1, d4r7dn1, d4r7dp1
automated match to d1dn0a2

Details for d4r7dp2

PDB Entry: 4r7d (more details), 2.75 Å

PDB Description: fab hu 15c1

PDB Compounds: (P:) Fab Hu 15C1 Light chain

SCOPe Domain Sequences for d4r7dp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r7dp2 b.1.1.2 (P:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d4r7dp2:

Click to download the PDB-style file with coordinates for d4r7dp2.
(The format of our PDB-style files is described here.)

Timeline for d4r7dp2: