Lineage for d2mqia_ (2mqi A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1918723Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1919108Protein Tyrosine kinase Fyn [55559] (1 species)
  7. 1919109Species Human (Homo sapiens) [TaxId:9606] [55560] (5 PDB entries)
  8. 1919112Domain d2mqia_: 2mqi A: [275381]
    automated match to d1aotf_

Details for d2mqia_

PDB Entry: 2mqi (more details)

PDB Description: human fyn sh2 free state
PDB Compounds: (A:) Tyrosine-protein kinase Fyn

SCOPe Domain Sequences for d2mqia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mqia_ d.93.1.1 (A:) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]}
wyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddmkgdhvkhykirkl
dnggyyittraqfetlqqlvqhyseraaglccrlvvpchk

SCOPe Domain Coordinates for d2mqia_:

Click to download the PDB-style file with coordinates for d2mqia_.
(The format of our PDB-style files is described here.)

Timeline for d2mqia_: