Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Tyrosine kinase Fyn [55559] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55560] (5 PDB entries) |
Domain d2mqia_: 2mqi A: [275381] automated match to d1aotf_ |
PDB Entry: 2mqi (more details)
SCOPe Domain Sequences for d2mqia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mqia_ d.93.1.1 (A:) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} wyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddmkgdhvkhykirkl dnggyyittraqfetlqqlvqhyseraaglccrlvvpchk
Timeline for d2mqia_: