![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (48 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:666] [188612] (22 PDB entries) |
![]() | Domain d5cnpe_: 5cnp E: [275373] Other proteins in same PDB: d5cnpa2, d5cnpd2 automated match to d3eg7b_ complexed with ipa, mg |
PDB Entry: 5cnp (more details), 2.38 Å
SCOPe Domain Sequences for d5cnpe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cnpe_ d.108.1.0 (E:) automated matches {Vibrio cholerae [TaxId: 666]} nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln
Timeline for d5cnpe_: