Lineage for d4ut5c_ (4ut5 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821276Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 2821277Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 2821278Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
    automatically mapped to Pfam PF07472
  6. 2821332Protein automated matches [190094] (4 species)
    not a true protein
  7. 2821411Species Pseudomonas aeruginosa [TaxId:381754] [275279] (1 PDB entry)
  8. 2821414Domain d4ut5c_: 4ut5 C: [275280]
    automated match to d4ce8a_
    complexed with ca, gal

Details for d4ut5c_

PDB Entry: 4ut5 (more details), 1.75 Å

PDB Description: crystal structure of the lecb lectin from pseudomonas aeruginosa strain pa7 in complex with lewis a tetrasaccharide
PDB Compounds: (C:) lecb lectin

SCOPe Domain Sequences for d4ut5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ut5c_ b.115.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 381754]}
atqgvftlpantrfgvtafanssatqtvkvlvnnetaatftgqstnnavigsqvlnsggg
gkvqiqvsvngrssdlvsaqvilanelnvalvgsedstdndyndavvvinwplg

SCOPe Domain Coordinates for d4ut5c_:

Click to download the PDB-style file with coordinates for d4ut5c_.
(The format of our PDB-style files is described here.)

Timeline for d4ut5c_: