Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) |
Protein Protein phosphatase-1 (PP-1) [56311] (6 species) |
Species Human (Homo sapiens), beta isoform [TaxId:9606] [64430] (7 PDB entries) Uniprot P36873 |
Domain d4ut2a_: 4ut2 A: [275278] automated match to d1jk7a_ complexed with mn, po4 |
PDB Entry: 4ut2 (more details), 1.96 Å
SCOPe Domain Sequences for d4ut2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ut2a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa
Timeline for d4ut2a_: