SCOPe 2.07: Domain d4ut2a_: 4ut2 A:

Lineage for d4ut2a_ (4ut2 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase-1 (PP-1) [56311] (6 species)

7. Species Human (Homo sapiens), beta isoform [TaxId:9606] [64430] (7 PDB entries)
   Uniprot P36873

8. Domain d4ut2a_: 4ut2 A: [275278]
   automated match to d1jk7a_
   complexed with mn, po4

Details for d4ut2a_

PDB Entry: 4ut2, 1.96 Å

PDB Description: x-ray structure of the human pp1 gamma catalytic subunit treated with ascorbate

PDB Compounds: (A:) Serine/threonine-protein phosphatase PP1-gamma catalytic subunit

SCOPe Domain Sequences for d4ut2a_:

Sequence; same for both SEQRES and ATOM records:

>d4ut2a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]}
klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

Timeline for d4ut2a_:

• d4ut2a_ first appeared in SCOPe 2.05
  
• d4ut2a_ appears in SCOPe 2.06
  
• d4ut2a_ appears in the current release, SCOPe 2.08