SCOPe 2.07: Domain d5c8ga_: 5c8g A:

Lineage for d5c8ga_ (5c8g A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:679716] [275175] (2 PDB entries)

8. Domain d5c8ga_: 5c8g A: [275177]
   automated match to d4a9ib_
   complexed with r78, unx

Details for d5c8ga_

PDB Entry: 5c8g, 1.95 Å

PDB Description: crystal structure analysis of pp-brd20 from tb427tmp complexed with bi-2536

PDB Compounds: (A:) pp-brd20

SCOPe Domain Sequences for d5c8ga_:

Sequence; same for both SEQRES and ATOM records:

>d5c8ga_ a.29.2.0 (A:) automated matches {Trypanosoma brucei [TaxId: 679716]}
lpknkhvfhsdqrlapeirdlydclyklyaeesaseyfrepvdalrvgawnyysvitepm
slrtvldyivqggryshveqimndveliwknceryngaeshlaadarrcrailekhrerl
ad

Timeline for d5c8ga_:

• d5c8ga_ first appeared in SCOPe 2.05
  
• d5c8ga_ appears in SCOPe 2.06
  
• d5c8ga_ appears in the current release, SCOPe 2.08