Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (14 species) not a true protein |
Species Trypanosoma brucei [TaxId:679716] [275175] (2 PDB entries) |
Domain d5c8ga_: 5c8g A: [275177] automated match to d4a9ib_ complexed with r78, unx |
PDB Entry: 5c8g (more details), 1.95 Å
SCOPe Domain Sequences for d5c8ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c8ga_ a.29.2.0 (A:) automated matches {Trypanosoma brucei [TaxId: 679716]} lpknkhvfhsdqrlapeirdlydclyklyaeesaseyfrepvdalrvgawnyysvitepm slrtvldyivqggryshveqimndveliwknceryngaeshlaadarrcrailekhrerl ad
Timeline for d5c8ga_: