| Class b: All beta proteins [48724] (149 folds) |
| Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (2 families) ![]() |
| Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins) |
| Protein Cyclophilin (eukaryotic) [50893] (10 species) |
| Species Plasmodium falciparum [50900] (2 PDB entries) |
| Domain d1qnhb_: 1qnh B: [27509] complexed with aba; mutant |
PDB Entry: 1qnh (more details), 2.1 Å
SCOP Domain Sequences for d1qnhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qnhb_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Plasmodium falciparum}
skrskvffdisidnsnagriifelfsditprtcenfralctgekigsrgknlhyknsifh
riipqfmcqggditngngsggesiygrsftdenfnmkhdqpgllsmanagpntnssqfli
tlvpcpwldgkhvvfgkviegmnvvremekegaksgyvkrsvvitdcgew
Timeline for d1qnhb_: