SCOPe 2.01: Domain d1e3ba_: 1e3b A:

Lineage for d1e3ba_ (1e3b A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Caenorhabditis elegans, isoform 3 [TaxId:6239] [50899] (3 PDB entries)

8. Domain d1e3ba_: 1e3b A: [27506]
   complexed with 3ep, au

Details for d1e3ba_

PDB Entry: 1e3b, 1.85 Å

PDB Description: cyclophilin 3 from c.elegans complexed with aup(et)3

PDB Compounds: (A:) cyclophilin 3

SCOPe Domain Sequences for d1e3ba_:

Sequence; same for both SEQRES and ATOM records:

>d1e3ba_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]}
msrskvffditiggkasgrivmelyddvvpktagnfralctgengigksgkplhfkgskf
hriipnfmiqggdftrgngtggesiygekfpdenfkekhtgpgvlsmanagpntngsqff
lctvktewldgkhvvfgrvvegldvvkavesngsqsgkpvkdcmiadcgqlk

Timeline for d1e3ba_:

• d1e3ba_ first appeared (with stable ids) in SCOP 1.55
  
• d1e3ba_ appears in SCOP 1.75
  
• d1e3ba_ appears in SCOPe 2.02
  
• d1e3ba_ appears in the current release, SCOPe 2.08