| Class b: All beta proteins [48724] (174 folds) |
| Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
| Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) |
| Protein Cyclophilin (eukaryotic) [50893] (13 species) |
| Species Caenorhabditis elegans, isoform 3 [TaxId:6239] [50899] (3 PDB entries) |
| Domain d1e3ba_: 1e3b A: [27506] complexed with 3ep, au |
PDB Entry: 1e3b (more details), 1.85 Å
SCOPe Domain Sequences for d1e3ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e3ba_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]}
msrskvffditiggkasgrivmelyddvvpktagnfralctgengigksgkplhfkgskf
hriipnfmiqggdftrgngtggesiygekfpdenfkekhtgpgvlsmanagpntngsqff
lctvktewldgkhvvfgrvvegldvvkavesngsqsgkpvkdcmiadcgqlk
Timeline for d1e3ba_: