Lineage for d1c5fm_ (1c5f M:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565060Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 565061Superfamily b.62.1: Cyclophilin-like [50891] (2 families) (S)
  5. 565062Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 565063Protein Cyclophilin (eukaryotic) [50893] (10 species)
  7. 565177Species Nematode (Brugia malayi) [TaxId:6279] [50898] (3 PDB entries)
  8. 565186Domain d1c5fm_: 1c5f M: [27503]

Details for d1c5fm_

PDB Entry: 1c5f (more details), 2.47 Å

PDB Description: crystal structure of the cyclophilin-like domain from brugia malayi complexed with cyclosporin a

SCOP Domain Sequences for d1c5fm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5fm_ b.62.1.1 (M:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi)}
kkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgs
tfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsq
ffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv

SCOP Domain Coordinates for d1c5fm_:

Click to download the PDB-style file with coordinates for d1c5fm_.
(The format of our PDB-style files is described here.)

Timeline for d1c5fm_: