Lineage for d3x33a_ (3x33 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579636Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 2579637Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 2579638Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. 2579709Protein automated matches [190702] (5 species)
    not a true protein
  7. 2579738Species Pig (Sus scrofa) [TaxId:9823] [275014] (4 PDB entries)
  8. 2579741Domain d3x33a_: 3x33 A: [275016]
    automated match to d2m33a_
    complexed with act, hem

Details for d3x33a_

PDB Entry: 3x33 (more details), 0.93 Å

PDB Description: crystal structure of the oxidized form of the solubilized domain of porcine cytochrome b5 in form 2 crystal
PDB Compounds: (A:) cytochrome b5

SCOPe Domain Sequences for d3x33a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x33a_ d.120.1.1 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
avkyytleeiqkhnnskstwlilhhkvydltkfleehpggeevlreqaggdatenfedvg
hstdarelsktfiigelhpddrskiak

SCOPe Domain Coordinates for d3x33a_:

Click to download the PDB-style file with coordinates for d3x33a_.
(The format of our PDB-style files is described here.)

Timeline for d3x33a_: