Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily) beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4) |
Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) |
Family d.120.1.1: Cytochrome b5 [55857] (5 proteins) |
Protein automated matches [190702] (5 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [275014] (4 PDB entries) |
Domain d3x33a_: 3x33 A: [275016] automated match to d2m33a_ complexed with act, hem |
PDB Entry: 3x33 (more details), 0.93 Å
SCOPe Domain Sequences for d3x33a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3x33a_ d.120.1.1 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]} avkyytleeiqkhnnskstwlilhhkvydltkfleehpggeevlreqaggdatenfedvg hstdarelsktfiigelhpddrskiak
Timeline for d3x33a_: