SCOPe 2.01: Domain d2rmce_: 2rmc E:

Lineage for d2rmce_ (2rmc E:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Mouse (Mus musculus), variant C [TaxId:10090] [50897] (1 PDB entry)

8. Domain d2rmce_: 2rmc E: [27493]

Details for d2rmce_

PDB Entry: 2rmc, 1.64 Å

PDB Description: crystal structure of murine cyclophilin c complexed with immunosuppressive drug cyclosporin a

PDB Compounds: (E:) peptidyl-prolyl cis-trans isomerase c

SCOPe Domain Sequences for d2rmce_:

Sequence; same for both SEQRES and ATOM records:

>d2rmce_ b.62.1.1 (E:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]}
krgpsvtdkvffdvrigdkdvgriviglfgnvvpktvenfvalatgekgygykgsifhrv
ikdfmiqggdftardgtggmsiygetfpdenfklkhygigwvsmanagpdtngsqffitl
tkptwldgkhvvfgkvldgmtvvhsielqatdghdrpltdctivnsgkidvktpfvvevp
dw

Timeline for d2rmce_:

• d2rmce_ first appeared (with stable ids) in SCOP 1.55
  
• d2rmce_ appears in SCOP 1.75
  
• d2rmce_ appears in SCOPe 2.02
  
• d2rmce_ appears in the current release, SCOPe 2.08