| Class b: All beta proteins [48724] (149 folds) |
| Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (2 families) ![]() |
| Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins) |
| Protein Cyclophilin (eukaryotic) [50893] (10 species) |
| Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (45 PDB entries) |
| Domain d3cysa_: 3cys A: [27488] complexed with aba |
PDB Entry: 3cys (more details)
SCOP Domain Sequences for d3cysa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cysa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
Timeline for d3cysa_: