SCOPe 2.05: Domain d5br9c2: 5br9 C:109-216

Lineage for d5br9c2 (5br9 C:109-216)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [274855] (1 PDB entry)

8. Domain d5br9c2: 5br9 C:109-216 [274865]
   automated match to d2gema2

Details for d5br9c2

PDB Entry: 5br9, 2.35 Å

PDB Description: crystal structure of an uncharacterized protein with similarity to peptidase yeaz from pseudomonas aeruginosa

PDB Compounds: (C:) Uncharacterized protein

SCOPe Domain Sequences for d5br9c2:

Sequence; same for both SEQRES and ATOM records:

>d5br9c2 c.55.1.0 (C:109-216) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
aervaaaidarmdevywgcyqlqqgemrlagseavlppervavpwdaaaadwfgagtgwg
yvermpqrpvaldasllphaedllslagfawargegveaeqalpvylr

Timeline for d5br9c2:

• d5br9c2 is new in SCOPe 2.05-stable
  
• d5br9c2 appears in SCOPe 2.06
  
• d5br9c2 appears in the current release, SCOPe 2.08