Lineage for d5br9c2 (5br9 C:109-216)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858878Species Pseudomonas aeruginosa [TaxId:208964] [274855] (1 PDB entry)
  8. 1858884Domain d5br9c2: 5br9 C:109-216 [274865]
    automated match to d2gema2

Details for d5br9c2

PDB Entry: 5br9 (more details), 2.35 Å

PDB Description: crystal structure of an uncharacterized protein with similarity to peptidase yeaz from pseudomonas aeruginosa
PDB Compounds: (C:) Uncharacterized protein

SCOPe Domain Sequences for d5br9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5br9c2 c.55.1.0 (C:109-216) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
aervaaaidarmdevywgcyqlqqgemrlagseavlppervavpwdaaaadwfgagtgwg
yvermpqrpvaldasllphaedllslagfawargegveaeqalpvylr

SCOPe Domain Coordinates for d5br9c2:

Click to download the PDB-style file with coordinates for d5br9c2.
(The format of our PDB-style files is described here.)

Timeline for d5br9c2: