| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (49 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:208964] [274855] (1 PDB entry) |
| Domain d5br9a1: 5br9 A:0-108 [274862] automated match to d3zeua1 |
PDB Entry: 5br9 (more details), 2.35 Å
SCOPe Domain Sequences for d5br9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5br9a1 c.55.1.0 (A:0-108) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
hmstllaldtsteacsvallhegralshyeviprlhaqrllpmvrdlldeagvalsavda
iafgrgpgaftgvriaigvvqglafalqrpvlavsdlailaqrayreqg
Timeline for d5br9a1: